HORDB

ID: hor003911
Uniprot ID: P01192
Protein name: NPP
Gene name: pomc
Organism: Sus scrofa (Pig)
Family: POMC family
Source: animal
Expression: ACTH and MSH are produced by the pituitary gland.
Disease: NA
Comments: NA
Taxonomy: Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity
GO BP: GO:0007218 neuropeptide signaling pathway; GO:2000852 regulation of corticosterone secretion
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule

Sequence: WCLESSQCQDLSTESNLLACIRACKPDLSAETPVFPGNGDAQPLTENPRKYVMGHFRWDRFGRRNGSSSGGGGGGGGAGQ
Length: 80
Propeptide: MPRLCGSRSGALLLTLLLQASMGVRGWCLESSQCQDLSTESNLLACIRACKPDLSAETPVFPGNGDAQPLTENPRKYVMGHFRWDRFGRRNGSSSGGGGGGGGAGQKREEEEVAAGEGPGPRGDGVAPGPRQDKRSYSMEHFRWGKPVGKKRRPVKVYPNGAEDELAEAFPLEFRRELAGAPPEPARDPEAPAEGAAARAELEYGLVAEAEAAEKKDEGPYKMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ
Signal peptide: MPRLCGSRSGALLLTLLLQASMGVRG
Modification: T61 Phenylalanine amide
Glycosylation: T65 N-linked (GlcNAc...) asparagine
Mutagenesis: NA

Function: [Corticotropin]: Stimulates the adrenal glands to release cortisol.; [Melanocyte-stimulating hormone alpha]: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Melanocyte-stimulating hormone beta]: Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Beta-endorphin]: Endogenous orexigenic opiate.; [Met-enkephalin]: Endogenous opiate.
Mechanism: NA
Cross BBB: NA
Target: MC4R, MC3R
Target Unid: O97504, A5GFS7
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor003911_AF2.pdb

hor003911_ESM.pdb

Mass:	985458	Formula:	C357H552N112O117S5
Absent amino acids:		Common amino acids:	G
pI:	7.13	Basic residues:	9
Polar residues:	34	Hydrophobic residues:	19
Hydrophobicity:	-67.75	Boman Index:	-16537
Half-Life:	2.8 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	47.63
Instability Index:	6562.63	Extinction Coefficient cystines:	12740
Absorbance 280nm:	161.27